PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C02347.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 361aa    MW: 39972.1 Da    PI: 8.0963
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C02347.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.94.9e-1468105340
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     +k+C Ckks+Clk+YC Cfa g +Cse+C C+ C+Nk+
  Pahal.C02347.1  68 CKHCACKKSRCLKLYCPCFAGGGYCSEKCGCQPCFNKD 105
                     89**********************************97 PP

2TCR49.96.1e-16153189339
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     k+gCnCkks+ClkkYC+C+++g+ Cs  C+C+dC+N 
  Pahal.C02347.1 153 KRGCNCKKSSCLKKYCDCYQDGTGCSLFCRCDDCQNP 189
                     78**********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.3E-1366107IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.02667191IPR005172CRC domain
PfamPF036384.6E-1069104IPR005172CRC domain
SMARTSM011141.2E-14151192IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.9E-11153188IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEATPISVKP PSPPPAAPPP AALEPRDLPT HAGAATEVEP SSMNQLAVAV TPDPKRQKVE  60
ETADGNGCKH CACKKSRCLK LYCPCFAGGG YCSEKCGCQP CFNKDAYAET VQTTRKVLLS  120
RQKRMSLKIN RRSEANAEAM EDAHHSSSST PPKRGCNCKK SSCLKKYCDC YQDGTGCSLF  180
CRCDDCQNPF GKNEGIMAED SKRYLYTGAD LDHSEGEHEF VVERSPRLQS PISKESSFHQ  240
TPPHLRASSR EAHVFPQAVS HWQALPRSWH CSNKRNNNDR AMDDSANYKN SNNDWQLPKH  300
EDSYSISKCV QILNGMVELS QVEKSVAPDV FLLPGNREIF ISLGGDVRAL WLKRKIQHLT  360
*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961563.10.0PREDICTED: CRC domain-containing protein TSO1-like
TrEMBLK3Z7D00.0K3Z7D0_SETIT; Uncharacterized protein
STRINGSi022450m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101592937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.18e-47Tesmin/TSO1-like CXC domain-containing protein